Description
IGF-1 LR3 Peptide Vial {name}
This product is intended for research and medical purposes only, to be only used by trained professionals.
IGF-1 LR3 studies provide a solution to problems posed by the failure of the growth hormone. IGF-1 LR3, additionally called LR3-IGF-1, is an extended and customized variation of naturally developing IGF-1. In contrast to IGF-1, IGF-1 LR3 insulin-like growth factor consists of 13 different amino acids and has the amino acid arginine replaced ready 3.
This peptide-like growth factor 1 has the same structural configuration and insulin size. IGF1 LR3 belongs to the group of peptides known as growth factors. IGF-1 LR3 1mg is essential for the growth hormones to develop in the muscles. The analogue is produced to facilitate the production of recombinant compounds.
These added amino acids boost the effectiveness of IGF-1 LR 3 to 3 times that of IGF binding proteins because it has around 1% affinity for IGF-binding healthy proteins, which act to obstruct the growth-promoting results of IGF1. As a result, the customized IGF-1 LR3 protein-peptide growth hormone has enhanced metabolic security and stays active in the body for longer than IGF-1 [1].
The lowered healthy protein binding and longer half-life suggest that the growth hormone peptide promotes muscle tissue and bone development and repair and smooth muscle survival [1]. IGF-1 LR3 has been revealed to boost mass muscle development and raise muscular tissue mass by approximately 50.
In addition, IGF-1 LR3 human growth hormone likewise regulates precisely how the body uses sugar by means of insulin signalling and can boost cost-free fat exercise and weight loss.
Useful Pages:
igf1 lr3 References:
- https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3792098/
IGF-1 LR3 Specifications:
igf1 lr3 Physical Appearance: White lyophilised solid
Purity: >98%
Molecular Weight: 9.1k
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Storage: Lyophilized peptides to be stored below -18°C
Research use only. Not for human or animal consumption!
DISCLAIMER:
We do not supply peptides to Any individual under the age of 18. You must be a licensed and qualified healthcare practitioner. Our team of dedicated professionals are committed to providing an extensive range of products used in the process of medical research by responsible trained and professional individuals. All products listed on this website (https://direct-peptides.com) and provided through Direct Peptides are intended for medical research purposes only. Direct Peptides does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption), nor are the products intended to be used as a drug, stimulant or for use in any food products.
BUY IGF-1 LRS online at Direct Peptides [name]